PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA34790
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family G2-like
Protein Properties Length: 390aa    MW: 43993.7 Da    PI: 5.9075
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA34790genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like71.81e-223891155
                    G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                               k+rl Wtp LH+ F++av+++ G++kA Pk++l++m+ +gL l+hv+SHLQkY++
  Tp57577_TGAC_v2_mRNA34790 38 KTRLSWTPALHQIFLSAVNHI-GIDKAKPKKLLKIMDCPGLELSHVASHLQKYKM 91
                               68*******************.*******************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.24E-143694IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-233794IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-183890IPR006447Myb domain, plants
Gene3DG3DSA:3.30.70.3303.1E-6228259IPR012677Nucleotide-binding alpha-beta plait domain
PfamPF015350.012308329IPR002885Pentatricopeptide repeat
PfamPF015350.083335362IPR002885Pentatricopeptide repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000166Molecular Functionnucleotide binding
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MNLFTANIPS FEDKGLKKRG RDDHDDHHVS KQQPVVKKTR LSWTPALHQI FLSAVNHIGI  60
DKAKPKKLLK IMDCPGLELS HVASHLQKYK MYLKGGIKNS KMNQFEFQGH NNYVVSTESI  120
DSPSTSLPQL GQYSVTPPDQ CDDSDIFFNL TDLFPNLNDD IHNNNYAVSA GSIDSPSTSL  180
PQLGQYSMTP PDQCDDSDIF FNLTDLFPNF NDDIHNVMWY LLPKNVGPCT LKITYSGHSD  240
ITVKFQSHRS RDYTNPYLPV AQSAIEGGGQ VMVGLDGKRL ETESNILRQL LWPGSLGRTL  300
HTDLSIKLCN KGMILEAEEV YGEMEGKGVN PEEEYTYGLL MDTCFKESQP YDAASYFRKM  360
VELRKEGREE DLTKLMEEKE RLKAEAKAK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11218DKGLKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1378281e-48AC137828.24 Medicago truncatula clone mth2-6c16, complete sequence.
GenBankAC1380561e-48AC138056.33 Medicago truncatula clone mth2-13i6, complete sequence.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-17response regulator 2